Description

  • Product name

    Recombinant Human AGPAT1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAV LAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVV VSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRK RTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQ AQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPAL ADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      1 to 283

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1 acyl sn glycerol 3 phosphate acyltransferase alpha
    • 1 acylglycerol 3 phosphate O acyltransferase 1
    • 1 acylglycerol 3 phosphate O acyltransferase 1 (acetoacetly Coenzyme A thiolase)
    • 1 acylglycerol 3 phosphate O acyltransferase 1 (lysophosphatidic acid acyltransferase alpha)
    • 1 AGP acyltransferase 1
    • 1 AGPAT1
    • AGPAT 1
    • G15
    • LPAAT alpha
    • LPAATA
    • Lysophosphatidic acid acyltransferase alpha
    • Lysophospholipid acyltransferase
    • MGC4007
    • MGC5423
    • OTTHUMP00000062693
    • Protein G15
    see all
  • Relevance

    AGPAT1 converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
  • Cellular localization

    Membrane; Multi-pass membrane protein.

Images

  • 12.5% SDS-PAGE analysis of ab132673 stained with Coomassie Blue.

References

ab132673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up