Description

  • Product name

    Recombinant Human ARMS2 protein (denatured)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMLRLYPGPMVTEAEGKGGPEMASLSSS VVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCL PAFFSPAGTQRRFQQPQHHLTLSIIHTAAR
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      1 to 107
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No.: NP_001093137
  • Description

    Recombinant Human ARMS2 protein

Specifications

Our Abpromise guarantee covers the use of ab174457 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • Age related maculopathy susceptibility 2
    • Age related maculopathy susceptibility protein 2 mitochondrial
    • ARMD8
    • ARMS2
    • ARMS2 age related maculopathy susceptibility 2
    • LOC387715
    • Macular degeneration age related 8
    see all
  • Relevance

    ARMS2 is thought to play a role in diseases in the elderly. Mutations in this gene have been associated with age-related macular degeneration (ARMD). ARMD is the most common cause of irreversible vision loss. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid (known as drusen) that lie beneath the retinal pigment epithelium and within an elastin containing structure known as Bruch's membrane. ARMD is likely to be a mechanistically heterogeneous group of disorders, and the specific disease mechanisms that underlie the vast majority of cases are currently unknown. However, studies have suggested that both genetic and environmental factors may be implicated.
  • Cellular localization

    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of ab174457 (3 µg)

References

ab174457 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174457.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up