Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGY SIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTS WESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGS QSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVF TKPQLWP
    • Molecular weight
      23 kDa including tags
    • Amino acids
      19 to 244

Specifications

Our Abpromise guarantee covers the use of ab111647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 12.01% Urea
    Note: Contains 67% Tris-HCl buffer.

General Info

  • Alternative names
    • Pentraxin 1, short
    • C reactive protein
    • C reactive protein pentraxin related
    • C-reactive protein(1-205)
    • CRP
    • CRP_HUMAN
    • MGC88244
    • Pentraxin 1
    • PTX 1
    • PTX1
    see all
  • Function
    Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
  • Tissue specificity
    Found in plasma.
  • Sequence similarities
    Belongs to the pentaxin family.
    Contains 1 pentaxin domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab111647 (3 µg)

References

This product has been referenced in:
  • Fang Z  et al. High-Throughput Study of the Effects of Celastrol on Activated Fibroblast-Like Synoviocytes from Patients with Rheumatoid Arthritis. Genes (Basel) 8:N/A (2017). Read more (PubMed: 28878153) »
  • Ko JA & Lim HB Metal-doped inorganic nanoparticles for multiplex detection of biomarkers by a sandwich-type ICP-MS immunoassay. Anal Chim Acta 938:1-6 (2016). Read more (PubMed: 27619081) »
See all 2 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your reply. I mistakenly typed in another '5' in previous value I gave you. Therefore the number should be 45045M-1 cm-1. Apologies for any confusion that it caused. Also just to reconfirm that you should have received 100ug of protein in the vial that was sent to you. Please let me know if there is anything else I can help you with

Read More

Answer

Thank you for contacting Abcam. I can confirm that there should have been 100ug protein in the vial that you received (you may have gotten a little more, but not that much). As for you extinction coefficient, using the http://web.expasy.org/cgi-bin/protparam/protparamprogram,I received a coefficient of 45045 5 M-1 cm-1. Please let me know if you have any further questions that I can help you with.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up