Description

  • Product name

    Recombinant Human FCRL3 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKEN SANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYE
    • Amino acids

      625 to 723
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD307c
    • Fc receptor homolog 3
    • Fc receptor-like protein 3
    • FcR-like protein 3
    • FcRH3
    • FcRL3
    • FCRL3_HUMAN
    • hIFGP3
    • IFGP family protein 3
    • IFGP3
    • Immune receptor translocation-associated protein 3
    • Immunoglobulin superfamily receptor translocation associated protein 3
    • IRTA3
    • SH2 domain-containing phosphatase anchor protein 2
    • SPAP2
    see all
  • Tissue specificity

    Primarily expressed in secondary lymphoid tissues by mature subsets of B cells. Detected in spleen, lymph node, peripheral blood lymphocytes, thymus, bone marrow, kidney, salivary gland, adrenal gland and uterus. Expressed a low levels in naive, germinal center and memory B cells but also expressed in NK cells (at protein level).
  • Involvement in disease

    Genetic variation in FCRL3 may be a cause of susceptibility to rheumatoid arthritis (RA) [MIM:180300]. It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures.
    Genetic variation in FCRL3 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism.
  • Sequence similarities

    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Phosphorylated on cytoplasmic tyrosines; required for interaction with protein tyrosine phosphatases and protein tyrosine kinases.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab165072 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up