Description

  • Product name

    Recombinant Human Fibulin 2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGDTIALNIIKGN EEGYFGTRRLNAYTGVVYLQRAVLEPRDFALDVEMKLWRQGSVTTFLAKM HIFFTTFAL
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      1076 to 1184

Specifications

Our Abpromise guarantee covers the use of ab114844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Fbln2
    • FBLN2_HUMAN
    • FIBL-2
    • Fibulin-2
    • OTTHUMP00000216670
    • OTTHUMP00000216671
    • OTTHUMP00000216672
    see all
  • Function

    Its binding to fibronectin and some other ligands is calcium dependent.
  • Tissue specificity

    Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.
  • Sequence similarities

    Belongs to the fibulin family.
    Contains 3 anaphylatoxin-like domains.
    Contains 11 EGF-like domains.
  • Developmental stage

    Widely expressed during embryonic development. Primarily detected within the neuropithelium, spinal ganglia and peripheral nerves.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab114844 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up