Overview

  • Product name

    Recombinant Human Galectin 10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACF LNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDI SLTKFNVSYLKR
    • Molecular weight

      19 kDa including tags
    • Amino acids

      1 to 162
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • BSF3
    • Charcot Leyden crystal protein
    • Charcot-Leyden crystal protein
    • CLC
    • EC 3.1.1.5
    • Eosinophil lysophospholipase
    • Gal-10
    • Galectin-10
    • LGALS10
    • LGALS10A
    • LPPL HUMAN
    • LPPL_HUMAN
    • Lysolecithin acylhydrolase
    • MGC149659
    see all
  • Function

    May have both lysophospholipase and carbohydrate-binding activities.
  • Tissue specificity

    Expressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils.
  • Sequence similarities

    Contains 1 galectin domain.
  • Cellular localization

    Cytoplasmic granule. Localized in granules from where it may be secreted or transported to other locations in the cell.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab107951 (3 µg).

References

ab107951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up