Description

  • Product name

    Recombinant Human MICAL2 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFY SKLKSKVTTWKAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLR TAIELAYLGAKVVVVEKRDSFSRNNVLHLWPFTIHDLRGLGAKKFYGKFC AGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPEDQENQKIGW RAEFLPTDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGKLAIAITANFI NRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQ LPSLDFAMNHYGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSL LEPFWPMGTGCARGFLAAFDTAWMVKSWNQGTPPLELLAERESLYRLLPQ TTPENINKNFEQYTLDPGTRYPNLNSHCVRPHQVKHLYITKELEH
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      1 to 495
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab241260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffered saline, 50% Glycerol

General Info

  • Alternative names

    • flavoprotein oxidoreductase MICAL2
    • KIAA0750
    • MICAL2PV1
    • MICAL2PV2
    • microtubule associated monoxygenase, calponin and LIM domain containing 2
    • Molecule interacting with CasL protein 2
    • Protein-methionine sulfoxide oxidase MICAL2
    see all
  • Relevance

    Interacts with VIM, PLXNA and RAB1B. The C-terminal coiled coil part contains the plexin-interacting region.
  • Cellular localization

    Cytoplasm; cytoskeleton.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab241260.

References

ab241260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up