Description

  • Product name

    Recombinant Human MRPL44 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRL LRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKS EEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPT EGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIG ALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNV SAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVA LRKLYGFTENRRPWNYSKPKETLRAEKSITAS
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      1 to 332

Specifications

Our Abpromise guarantee covers the use of ab133009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 39S ribosomal protein L44, mitochondrial
    • COXPD16
    • EC 3.1.26
    • FLJ12701
    • FLJ13990
    • FLJ37688
    • L44MT
    • mitochondrial ribosomal protein L44
    • MRP L44
    see all
  • Relevance

    MRPL44 is a component of the 39S subunit of mitochondrial ribosome.
  • Cellular localization

    Mitochondrial

Images

  • 12.5% SDS-PAGE analysis of ab133009 stained with Coomassie Blue.

References

ab133009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up