Recombinant Human Macrophage Inflammatory Protein 3 alpha (Fc Chimera) (ab216229)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 5.000 Eu/mg
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Macrophage Inflammatory Protein 3 alpha (Fc Chimera)
See all Macrophage Inflammatory Protein 3 alpha proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 5.000 Eu/mg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCAN PKQTWVKYIV RLLSKKVKNM -
Predicted molecular weight
38 kDa including tags -
Amino acids
27 to 96 -
Additional sequence information
Extracellular domain (aa 27-96) fused to the N-terminus of the Fc region of Human IgG1. This product is for the mature full length protein. The signal peptide is not included (AAH20698.1).
-
Specifications
Our Abpromise guarantee covers the use of ab216229 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 100% PBS
-
ReconstitutionReconstitute vial in 50µl sterile water. Add 1X PBS to the desired protein concentration.
General Info
-
Alternative names
- Beta chemokine exodus 1
- Beta-chemokine exodus-1
- C C motif chemokine ligand 20
see all -
Function
Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213. -
Tissue specificity
Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intestine and colon. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsC-terminal processed forms which lack 1, 3 or 6 amino acids are produced by proteolytic cleavage after secretion from peripheral blood monocytes. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab216229 has not yet been referenced specifically in any publications.