Recombinant Human S100 alpha 6/PRA protein (ab167733)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human S100 alpha 6/PRA protein
See all S100 alpha 6/PRA proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab167733 was lyophilized from 0.22 µm filtered solution. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG -
Predicted molecular weight
10 kDa -
Amino acids
1 to 90
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab167733 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as S100 alpha 6.
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.40
Constituents: 94% PBS, 5% Trehalose -
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 300 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- 2A9
- 5B10
- CABP
see all -
Function
May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative. -
Sequence similarities
Belongs to the S-100 family.
Contains 2 EF-hand domains. -
Post-translational
modificationsThe N-terminus is blocked. -
Cellular localization
Nucleus envelope. Cytoplasm. Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab167733 has not yet been referenced specifically in any publications.