Description

  • Product name

    Recombinant Human S100A11 protein
    See all S100A11 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab104643 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMAKISSPTETERCIESLIAVFQKYAG KDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLD FSEFLNLIGGLAMACHDSFLKAVPSQKRT
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      1 to 105
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Calgizzarin
    • Epididymis secretory protein Li 43
    • HEL S 43
    • Metastatic lymph node gene 70 protein
    • MLN 70
    • MLN70
    • Protein S100 A11
    • Protein S100-A11
    • Protein S100-A11, N-terminally processed
    • Protein S100-C
    • Protein S100A11
    • Protein S100C
    • S100 A11
    • S100 calcium binding protein A11
    • S100 calcium-binding protein A11
    • S100 calcium-binding protein A11 (calgizzarin)
    • S100a11
    • S100C
    • S10AB_HUMAN
    see all
  • Function

    Facilitates the differentiation and the cornification of keratinocytes.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications

    Phosphorylation at Thr-10 by PRKCA significantly suppresses homodimerization and promotes association with NCL/nucleolin which induces nuclear translocation.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab104643 at approximately 14.2kDa (3µg).

References

ab104643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up