Description

  • Product name

    Recombinant Human SCRN1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab202177 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAAAPPSYCFVAFPPRAKDGLVVFGKN SARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMISRPAWLW GAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEAL DVIVSLLEEHGQGGNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAA EKVTEGVRCICSQLSLTTKMDAEHPELRSYAQSQGWWTGEGEFNFSEVFS PVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTAS GVSVLPQNRSSPCIHYFTGTPDPSRSIFKPFIFVDDVKLVPKTQSPCFGD DDPAKKEPRFQEKPDRRHELYKAHEWARAIIESDQEQGRKLRSTMLELEK QGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      1 to 414
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001138985.

Specifications

Our Abpromise guarantee covers the use of ab202177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • KIAA0193
    • OTTHUMP00000202313
    • SCRN 1
    • SCRN1
    • SCRN1_HUMAN
    • Secernin 1
    • Secernin-1
    • Secernin1
    • SES1
    see all
  • Function

    Regulates exocytosis in mast cells. Increases both the extent of secretion and the sensitivity of mast cells to stimulation with calcium.
  • Sequence similarities

    Belongs to the peptidase C69 family. Secernin subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202177 (3 µg).

References

ab202177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up