Recombinant Human Synapsin I protein (ab152720)
Key features and details
- Expression system: Wheat germ
- Suitable for: SDS-PAGE, WB, ELISA
Description
-
Product name
Recombinant Human Synapsin I protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVV NKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ -
Predicted molecular weight
36 kDa including tags -
Amino acids
362 to 450
-
Specifications
Our Abpromise guarantee covers the use of ab152720 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Western blot
ELISA
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Brain protein 4.1
- SYN 1
- SYN 1a
see all -
Function
Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level. -
Involvement in disease
Defects in SYN1 are a cause of epilepsy X-linked with variable learning disabilities and behavior disorders [MIM:300491]. XELBD is characterized by variable combinations of epilepsy, learning difficulties, macrocephaly, and aggressive behavior. -
Sequence similarities
Belongs to the synapsin family. -
Post-translational
modificationsSubstrate of at least four different protein kinases. It is probable that phosphorylation plays a role in the regulation of synapsin-1 in the nerve terminal. Phosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cell junction > synapse. Golgi apparatus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab152720 has not yet been referenced specifically in any publications.