Overview

  • Product name

    Recombinant Human TRIP6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLP SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLL SSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYG GPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHF PLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQ PPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRI LRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCS VCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYP LDGHILCKACSAWRIQELSATVTTDC
    • Molecular weight

      78 kDa including tags
    • Amino acids

      1 to 476

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132099 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC10556
    • MGC10558
    • MGC29959
    • MGC3837
    • MGC4423
    • OIP-1
    • OIP1
    • OPA interacting protein 1
    • OPA-interacting protein 1
    • Thyroid hormone receptor interactor 6
    • Thyroid receptor interacting protein 6
    • Thyroid receptor-interacting protein 6
    • TR-interacting protein 6
    • TRIP-6
    • Trip6
    • TRIP6_HUMAN
    • TRIP6i2
    • ZRP 1
    • ZRP-1
    • Zyxin-related protein 1
    see all
  • Function

    Relays signals from the cell surface to the nucleus to weaken adherens junction and promote actin cytoskeleton reorganization and cell invasiveness. Involved in lysophosphatidic acid-induced cell adhesion and migration. Acts as a transcriptional coactivator for NF-kappa-B and JUN, and mediates the transrepression of these transcription factors induced by glucocorticoid receptor.
  • Tissue specificity

    Abundantly expressed in kidney, liver and lung. Lower levels in heart, placenta and pancreas. Expressed in colonic epithelial cells. Up-regulated in colonic tumors.
  • Sequence similarities

    Belongs to the zyxin/ajuba family.
    Contains 3 LIM zinc-binding domains.
  • Domain

    The LIM zinc-binding domains mediate interaction with LPAR2 and with S.typhimurium protein sseI.
  • Post-translational
    modifications

    Phosphorylation at Tyr-55 by SRC is required for enhancement of lysophosphatidic acid-induced cell migration. Tyr-55 is dephosphorylated by PTPN13.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Nucleus. Cytoplasm. Shuttles between nucleus and cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132099 stained with Coomassie Blue.

References

ab132099 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132099.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up