Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
Key features and details
- Expression system: Saccharomyces cerevisiae
- Purity: > 95% SDS-PAGE
- Suitable for: WB, ELISA, SDS-PAGE
Description
-
Product name
Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein -
Purity
> 95 % SDS-PAGE.
ab74559 is purified by ultracentifugation. -
Expression system
Saccharomyces cerevisiae -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Sequence
MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSR LLDRLVRLIGNPDVSGPKLTGALIGILSLFVESPGQLIQRITDDPDVSIR LLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFGNK EISDIEVQDPEGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYT QQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDIKRTPGNKPRI AEMICDIDTYIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLM NLYQQMGETAPYMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGL NFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDARLVSEIAMH TTEDKISRAVGPRQAQVSFLHGDQSENELPRLGGKEDRRVKQSRGEARES YRETGPSRASDARAAHLPTGTPLDIDTATESSQDPQDSRRSADALLRLQA MAGISEEQGSDTDTPIVYNDRNLLD -
Predicted molecular weight
58 kDa -
Amino acids
1 to 525
-
Specifications
Our Abpromise guarantee covers the use of ab74559 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituent: PBS
-
ReconstitutionLyophilised, reconstitute with 120µl deionised water and add glycerol to 50%
General Info
-
Alternative names
- N
-
Relevance
Priorix is a new investigational measles, mumps and rubella (MMR) vaccine containing the Schwarz measles strain, the RA 27/3 rubella strain and a new mumps strain RIT 4385.
Images
-
All lanes : Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
Lanes 1-2 : S. cerevisiae cell lysates without measles nucleoprotein (negative controls)
Lane 3 : S. cerevisiae cell lysate with recombinantly expressed measles nucleoprotein
Lane 4 : CsCl purified measles Nucleoprotein from S. cerevisiae
Predicted band size: 60 kDa -
All lanes : Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
Lanes 1-2 : S. cerevisiae cell lysates without measles nucleoprotein (negative controls)
Lane 3 : S. cerevisiae cell lysate with recombinantly expressed measles nucleoprotein
Lane 4 : CsCl purified measles Nucleoprotein from S. cerevisiae
Predicted band size: 60 kDaSDS-PAGE and WB of yeast lysates and purified Measles Nucleoprotein (ab74559) on a 12% polyacrylamide gel. Immunoblot using measles positive human serum.
-
All lanes : Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
Lanes 1-2 : S. cerevisiae cell lysates without measles nucleoprotein (negative controls)
Lane 3 : S. cerevisiae cell lysate with recombinantly expressed measles nucleoprotein
Lane 4 : CsCl purified measles Nucleoprotein from S. cerevisiae
Predicted band size: 60 kDaSDS-PAGE and WB of yeast lysates and purified Measles Nucleoprotein (ab74559) on a 12% polyacrylamide gel.
Immunoblot using Mab against measles nucleoprotein
-
SDS-PAGE showing ab74559 at approximately 60kDa. (2 μg/lane).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab74559 has been referenced in 3 publications.
- Böröcz K et al. Application of a fast and cost-effective 'three-in-one' MMR ELISA as a tool for surveying anti-MMR humoral immunity: the Hungarian experience. Epidemiol Infect 148:e17 (2020). PubMed: 32014073
- Hong J et al. Correlation between the results of two analytical methods for measuring measles virus neutralizing antibodies in source plasma and therapeutic immunoglobulin products. Biologicals 59:20-28 (2019). PubMed: 30992162
- Richardson SI et al. IgG3 enhances neutralization potency and Fc effector function of an HIV V2-specific broadly neutralizing antibody. PLoS Pathog 15:e1008064 (2019). PubMed: 31841557