Recombinant human GDF6 protein (Active) (ab245811)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
Description
-
Product name
Recombinant human GDF6 protein (Active)
See all GDF6 proteins and peptides -
Biological activity
Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 2.0-3.0 µg/ml.
-
Purity
>= 95 % SDS-PAGE.
= 95% by HPLC.. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEG VCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDA GNNVVYKQYEDMVVESCGCR -
Predicted molecular weight
14 kDa -
Amino acids
336 to 455 -
Additional sequence information
Full length chain without signal peptide, without propeptide. Product is 27.0 kDa homodimeric disulfide-linked protein consisting of two 120 amino acid polypeptide chains
-
Specifications
Our Abpromise guarantee covers the use of ab245811 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Additional notes
Manufactured using all animal-free reagents.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acid
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in water to 0.1-1.0 mg/ml.
General Info
-
Alternative names
- bmp 13
- BMP-13
- bmp13
see all -
Function
Growth factor that controls proliferation and cellular differentiation in the retina and bone formation. Plays a key role in regulating apoptosis during retinal development. Establishes dorsal-ventral positional information in the retina and controls the formation of the retinotectal map (PubMed:23307924). Required for normal formation of bones and joints in the limbs, skull, digits and axial skeleton. Plays a key role in establishing boundaries between skeletal elements during development. Regulation of GDF6 expression seems to be a mechanism for evolving species-specific changes in skeletal strucutres. Seems to positively regulates differentiation of chondrogenic tissue through the growth factor receptors subunits BMPR1A, BMPR1B, BMPR2 and ACVR2A, leading to the activation of SMAD1-SMAD5-SMAD8 complex. The regulation of chondrogenic differentiation is inhibited by NOG (PubMed:26643732). Also involved in the induction of adipogenesis from mesenchymal stem cells. This mechanism acts through the growth factor receptors subunits BMPR1A, BMPR2 and ACVR2A and the activation of SMAD1-SMAD5-SMAD8 complex and MAPK14/p38. -
Involvement in disease
Klippel-Feil syndrome 1, autosomal dominant
A chromosomal aberration involving GDF6 has been found in a patient with Klippel-Feil syndrome (KFS). Paracentric inv(8)(q22;2q23.3).
Microphthalmia, isolated, 4
Leber congenital amaurosis 17
Defects in POP1 may be the cause of multiple synostoses syndrome (SYNS). SYNS is a bone disease characterized by multiple progressive joint fusions that commonly involve proximal interphalangeal, tarsal-carpal joints. Additional features can include progressive conductive deafness. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab245811 has not yet been referenced specifically in any publications.