Anti-RNase 7 antibody [CL0224] (ab154143)
Key features and details
- Mouse monoclonal [CL0224] to RNase 7
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-RNase 7 antibody [CL0224]
See all RNase 7 primary antibodies -
Description
Mouse monoclonal [CL0224] to RNase 7 -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human RNase 7 aa 31-155.
Sequence:KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVA ATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSY VVACKPPQKKDSQQFHLVPVHLDRV
-
Positive control
- Human skin, kidney and fallopian tube tissues; RNase 7 over-expression HEK293T lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
CL0224 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab154143 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
IHC-P
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Exhibits a potent RNase activity. Has broad-spectrum antimicrobial activity against many pathogenic microorganisms and remarkably potent activity (lethal dose of 90% < 30 nM) against a vancomycin resistant Enterococcus faecium. -
Tissue specificity
Expressed in various epithelial tissues including skin, respiratory tract, genito-urinary tract and, at a low level, in the gut. Expressed in liver, kidney, skeletal muscle and heart. -
Sequence similarities
Belongs to the pancreatic ribonuclease family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 84659 Human
- Omim: 612484 Human
- SwissProt: Q9H1E1 Human
- Unigene: 525206 Human
-
Alternative names
- EC 3.1.27.- antibody
- MGC133220 antibody
- Ribonuclease 7 antibody
see all
Images
-
Immunohistochemical analysis of Human skin tissue labeling RNase 7 with ab154143 at 1/50 dilution.
-
Immunohistochemical analysis of Human kidney tissue labeling RNase 7 with ab154143 at 1/50 dilution.
-
Immunohistochemical analysis of Human fallopian tube tissue labeling RNase 7 with ab154143 at 1/50 dilution.
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab154143 has been referenced in 2 publications.
- Neopane P et al. Immunohistochemical Localization of RNase 7 in Normal and Inflamed Oral Epithelia and Salivary Glands. Acta Histochem Cytochem 52:35-43 (2019). PubMed: 31341339
- Patra V et al. Unique profile of antimicrobial peptide expression in polymorphic light eruption lesions compared to healthy skin, atopic dermatitis, and psoriasis. Photodermatol Photoimmunol Photomed 34:137-144 (2018). IHC-P ; Human . PubMed: 29044786