Anti-SKAP antibody (ab122769)
Key features and details
- Rabbit polyclonal to SKAP
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SKAP antibody -
Description
Rabbit polyclonal to SKAP -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SKAP aa 85-169.
Sequence:TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPEND VTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
-
Positive control
- IHC: Human testis tissue ICC/IF: Human cell line A-431
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122769 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
|
IHC-P |
1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
IHC-P
1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 90417 Human
- Omim: 614718 Human
- SwissProt: Q9Y448 Human
- Unigene: 525796 Human
-
Alternative names
- KNSTRN antibody
- C15orf23 antibody
- chromosome 15 open reading frame 23 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (4)
ab122769 has been referenced in 4 publications.
- Wei R et al. Integrative Analysis of Biomarkers Through Machine Learning Identifies Stemness Features in Colorectal Cancer. Front Cell Dev Biol 9:724860 (2021). PubMed: 34568334
- Huo X et al. Clinical and Expression Significance of AKT1 by Co-expression Network Analysis in Endometrial Cancer. Front Oncol 9:1147 (2019). PubMed: 31781484
- Lu S et al. Small kinetochore associated protein (SKAP) promotes UV-induced cell apoptosis through negatively regulating pre-mRNA processing factor 19 (Prp19). PLoS One 9:e92712 (2014). WB ; Human . PubMed: 24718257
- Lee CS et al. Recurrent point mutations in the kinetochore gene KNSTRN in cutaneous squamous cell carcinoma. Nat Genet 46:1060-2 (2014). PubMed: 25194279