Anti-SNRNP200 antibody (ab176715)
Key features and details
- Rabbit polyclonal to SNRNP200
- Suitable for: IHC-P, WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SNRNP200 antibody
See all SNRNP200 primary antibodies -
Description
Rabbit polyclonal to SNRNP200 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide within Human SNRNP200 aa 400-450. The exact sequence is proprietary. NP_054733.2
Sequence:GEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPA L
Database link: O75643 -
Positive control
- WB: HeLa, 293T, Jurkat and NIH3T3 whole cell lysates. IP: HeLa whole cell lysate. IHC-P: Human colon carcinoma tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7.0-8.0 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176715 was affinity purified using an epitope specific to SNRNP200 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176715 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/1000.
|
|
WB |
1/2000 - 1/10000. Predicted molecular weight: 245 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
IHC-P
1/1000. |
WB
1/2000 - 1/10000. Predicted molecular weight: 245 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Function
Putative RNA helicase involved in the second step of RNA splicing. May promote one or more conformational changes in the dynamic network of RNA-RNA interactions in the spliceosome. Appears to catalyze an ATP-dependent unwinding of U4/U6 RNA duplices. -
Tissue specificity
Widely expressed. -
Involvement in disease
Defects in SNRNP200 are the cause of retinitis pigmentosa type 33 (RP33) [MIM:610359]. It is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. -
Sequence similarities
Belongs to the helicase family. SKI2 subfamily.
Contains 2 helicase ATP-binding domains.
Contains 2 helicase C-terminal domains.
Contains 2 SEC63 domains. -
Domain
Composed of two similar domains. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 23020 Human
- Entrez Gene: 320632 Mouse
- Omim: 601664 Human
- SwissProt: O75643 Human
- SwissProt: Q6P4T2 Mouse
- Unigene: 246112 Human
-
Alternative names
- Activating signal cointegrator 1 complex subunit 3-like 1 antibody
- ASCC3L1 antibody
- BRR2 antibody
see all
Images
-
All lanes : Anti-SNRNP200 antibody (ab176715) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Lane 5 : NIH3T3 whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 245 kDa
Exposure time: 30 seconds -
SNRNP200 was immunoprecipitated from 1mg HeLa whole cell lysate using ab176715 at 6 μg/mg lysate (Lane 2), a rabbit anti-SNRNP200 antibody recognizing an upstream epitope (Lane 1) or control IgG (Lane 3). 20% of the Immunoprecipitate was loaded per lane and then immunobotted using ab176715 at 1.0 μg/ml.
Detection:
Chemiluminescence with exposure time of 10 seconds.
-
Immunohistochemical (Formalin/PFA-fixed paraffin-embedded sections) analysis of human colon carcinoma tissue sections using ab176715 at 1/1000 dilution (1 µg/mL).
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab176715 has been referenced in 1 publication.
- Su X et al. Depletion of SNRNP200 inhibits the osteo-/dentinogenic differentiation and cell proliferation potential of stem cells from the apical papilla. BMC Dev Biol 20:22 (2020). PubMed: 33203369