Overview

  • Product name
    Anti-SSB-1 antibody
  • Description
    Rabbit polyclonal to SSB-1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human SSB-1 aa 95-144 (internal sequence).
    Sequence:

    RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL


    Database link: NP_079382

  • Positive control
    • Human Fetal lung lysate
  • General notes

    Previously labelled as SPSB1.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab135427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa.

Target

  • Function
    Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the SPSB family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes (By similarity). The B30.2/SPRY domain is involved in MET binding.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1110014L01Rik antibody
    • 4930422J18Rik antibody
    • AI596360 antibody
    • AI854583 antibody
    • MGC102221 antibody
    • novel SPRY domain containing protein antibody
    • OTTHUMP00000001398 antibody
    • OTTMUSP00000010942 antibody
    • OTTMUSP00000010943 antibody
    • OTTMUSP00000023475 antibody
    • RGD1309319 antibody
    • RP23-169H13.1 antibody
    • RP3-324M8.1 antibody
    • splA/ryanodine receptor domain and SOCS box containing 1 antibody
    • SPRY domain containing SOCS box protein SSB 1 antibody
    • SPRY domain-containing SOCS box protein 1 antibody
    • SPSB1 antibody
    • SPSB1_HUMAN antibody
    • SSB 1 antibody
    • SSB-1 antibody
    • SSB1 antibody
    see all

Images

  • Anti-SSB-1 antibody (ab135427) at 1 µg/ml + Human Fetal lung lysate at 10 µg

    Predicted band size: 30 kDa



    Blocked with 5% milk.

References

ab135427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up