Overview

  • Product name
    Anti-SWSAP1 antibody
  • Description
    Rabbit polyclonal to SWSAP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SWSAP1 aa 32-120.
    Sequence:

    EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCS AHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD


    Database link: Q6NVH7

  • Positive control
    • Human kidney tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab185360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    ATPase which is preferentially stimulated by single-stranded DNA and is involved in homologous recombination repair (HRR). Has a DNA-binding activity which is independent of its ATPase activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATPase SWSAP1 antibody
    • C19orf39 antibody
    • SWAP1_HUMAN antibody
    • SWIM-type zinc finger 7-associated protein 1 antibody
    • SWS1-associated protein 1 antibody
    • SWS1AP1 antibody
    • SWSAP1 antibody
    • Zinc finger SWIM type containing 7 associated protein 1 antibody
    • ZSWIM7-associated protein 1 antibody
    • ZSWIM7AP1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling SWSAP1 with an185360 at 1/200 dilution.

References

ab185360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up