Overview

  • Product name
    Anti-Swi6 antibody
  • Description
    Rabbit polyclonal to Swi6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IP, ChIPmore details
  • Species reactivity
    Reacts with: Schizosaccharomyces pombe
  • Immunogen

    Recombinant full length protein corresponding to Schizosaccharomyces pombe Swi6 aa 1-328.
    Sequence:

    MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEV ESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEY LLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARP KKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENG PPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVT PKKKPSPE VPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAI SHHPSTITNKKCPQKMLQFYESHLTFRENE


    Database link: P40381

  • Positive control
    • S. pombe Swi6 protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 37 kDa.
IP Use at an assay dependent concentration.
ChIP Use at an assay dependent concentration.

Target

  • Relevance
    The chromatin structure of Fission yeast centromeres is regulated epigenetically. In the central core domain, the histone H3 variant Cnp1(CENP-A) plays a key role. In the flanking heterochromatin domain, histones are kept underacetylated by the histone deacetylases (HDACs) Clr3, Clr6 and Sir2, and methylated by Clr4 methyltransferase (HMTase) to create a specific binding site for the Swi6 protein. Swi6 then directly mediates cohesin binding to the centromeric heterochromatin. Recognizes and binds histone H3 tails methylated at Lys-9, leading to epigenetic repression. Involved in the repression of the silent mating-type loci MAT2 and MAT3. May compact MAT2/3 into a heterochromatin-like conformation which represses the transcription of these silent cassettes. Swi6 interacts with histone H3 methylated at Lys-9 and with the cohesin subunit psc3. Swi6 associates with Swi4 to activate HO and many other late G1-specific transcripts in budding yeast. In contrast, histone H3 methylated at Lys9 and its interacting protein Swi6/HP1, which define heterochromatin, coated extended domains associated with a variety of repeat elements and small islands corresponding to meiotic genes. Contains two chromo domains.
  • Cellular localization
    Nuclear
  • Database links
    • Alternative names
      • Chromatin associated protein swi6 antibody
      • Chromodomain protein Swi6 antibody
      • SPAC664.01c antibody
      • SPAC824.10c antibody
      • Swi 6 antibody
      • swi6 antibody
      see all

    Images

    • Anti-Swi6 antibody (ab188276) at 1/2000 dilution + S. pombe Swi6 protein

      Predicted band size: 37 kDa

    References

    This product has been referenced in:
    • Sadeghi L  et al. The Paf1 complex factors Leo1 and Paf1 promote local histone turnover to modulate chromatin states in fission yeast. EMBO Rep 16:1673-87 (2015). ChIP ; Schizosaccharomyces pombe . Read more (PubMed: 26518661) »
    See 1 Publication for this product

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab188276.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up