Anti-TLR8 antibody (ab53630)
Key features and details
- Goat polyclonal to TLR8
- Suitable for: IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TLR8 antibody
See all TLR8 primary antibodies -
Description
Goat polyclonal to TLR8 -
Host species
Goat -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide:
CESFQGLQNLTKINLNHNPNVQHQNGNPGI
, corresponding to amino acids 81-109 of Human TLR8 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.1% Sodium azide
Constituents: 0.1% BSA, 0.21% Potassium phosphate, 0.812% Sodium chloride, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab53630 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
Use at an assay dependent concentration.
|
Notes |
---|
IHC-P
Use at an assay dependent concentration. |
Target
-
Function
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. -
Tissue specificity
Detected in brain, heart, lung, liver, placenta, in monocytes, and at lower levels in CD11c+ immature dendritic cells. -
Sequence similarities
Belongs to the Toll-like receptor family.
Contains 23 LRR (leucine-rich) repeats.
Contains 1 LRRCT domain.
Contains 1 TIR domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 51311 Human
- Entrez Gene: 170744 Mouse
- Omim: 300366 Human
- SwissProt: Q9NR97 Human
- SwissProt: P58682 Mouse
- Unigene: 660543 Human
- Unigene: 196676 Mouse
-
Alternative names
- CD 288 antibody
- CD288 antibody
- CD288 antigen antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab53630 has been referenced in 3 publications.
- Wang Y et al. Increased infiltration of CD11 c+/CD123+ dendritic cell subsets and upregulation of TLR/IFN-a signaling participate in pathogenesis of oral lichen planus. Oral Surg Oral Med Oral Pathol Oral Radiol 125:459-467.e2 (2018). IHC-P . PubMed: 29429903
- Jiang C et al. The Expression of Toll-like receptors in eutopic and ectopic endometrium and its implication in the inflammatory pathogenesis of adenomyosis. Sci Rep 7:7365 (2017). PubMed: 28779087
- Thiyagarajan D et al. Silencing of Renal DNaseI in Murine Lupus Nephritis Imposes Exposure of Large Chromatin Fragments and Activation of Toll Like Receptors and the Clec4e. PLoS One 7:e34080 (2012). PubMed: 22479529