Overview

  • Product name

  • Description

    Rabbit polyclonal to TSG6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human TSG6 aa 184-255.
    Sequence:

    DDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDA SVTAGGFQIKYVAMDPVSKSSQ


    Database link: P98066

  • Positive control

    • Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis.
  • Tissue specificity

    Found in the synovial fluid of patients with rheumatoid arthritis.
  • Sequence similarities

    Contains 1 CUB domain.
    Contains 1 Link domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hyaluronate binding protein antibody
    • Hyaluronate-binding protein antibody
    • TNF alpha induced protein 6 antibody
    • TNF alpha-induced protein 6 antibody
    • TNF stimulated gene 6 protein antibody
    • TNF-stimulated gene 6 protein antibody
    • TNFAIP 6 antibody
    • Tnfaip6 antibody
    • TSG 6 antibody
    • TSG-6 antibody
    • TSG6_HUMAN antibody
    • Tumor necrosis factor alpha induced protein 6 antibody
    • Tumor necrosis factor alpha inducible protein 6 antibody
    • Tumor necrosis factor alpha-induced protein 6 antibody
    • Tumor necrosis factor inducible gene 6 protein antibody
    • Tumor necrosis factor stimulated gene 6 protein antibody
    • Tumor necrosis factor-inducible gene 6 protein antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling TSG6 with ab204049 at 1/50.

References

ab204049 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up