Overview

  • Product name

    Anti-Thrombopoietin antibody
    See all Thrombopoietin primary antibodies
  • Description

    Rabbit polyclonal to Thrombopoietin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Thrombopoietin aa 22-349.
    Sequence:

    SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGE WKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLL LGALQSLLGTQLPPQGRTTAHKDPNAIFLFQHLLRGKVRFLMLVGGSTLC VRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKQQ GFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPD ISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPL LPDPSAPTPTPTSPLLNTSYTHSQNL


    Database link: P40225

  • Positive control

    • 293 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab180728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 37 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
  • Involvement in disease

    Defects in THPO are a cause of essential thrombocythemia (ET) [MIM:187950]. ET is inherited as an autosomal dominant trait which is characterized by elevated platelet levels due to sustained proliferation of megakaryocytes, and frequently lead to thrombotic and haemorrhagic complications.
  • Sequence similarities

    Belongs to the EPO/TPO family.
  • Domain

    Two-domain structure with an erythropoietin-like N-terminal and a Ser/Pro/Thr-rich C-terminal.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C mpl ligand antibody
    • C-mpl ligand antibody
    • Megakaryocyte colony stimulating factor antibody
    • Megakaryocyte colony-stimulating factor antibody
    • Megakaryocyte growth and development factor antibody
    • Megakaryocyte stimulating factor antibody
    • MGC163194 antibody
    • MGDF antibody
    • MKCSF antibody
    • ML antibody
    • MPL ligand antibody
    • MPLLG antibody
    • Myeloproliferative leukemia virus oncogene ligand antibody
    • Prepro thrombopoietin antibody
    • THCYT1 antibody
    • THPO antibody
    • Thrombopoietin antibody
    • Thrombopoietin nirs variant 1 antibody
    • TPO antibody
    • TPO_HUMAN antibody
    see all

Images

  • Anti-Thrombopoietin antibody (ab180728) at 1/500 dilution + 293 cell lysate

    Predicted band size: 37 kDa

References

ab180728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up