Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612)
Key features and details
- Rabbit polyclonal to Thyroid Hormone Receptor beta - N-terminal
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Thyroid Hormone Receptor beta antibody - N-terminal
See all Thyroid Hormone Receptor beta primary antibodies -
Description
Rabbit polyclonal to Thyroid Hormone Receptor beta - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Sheep -
Immunogen
Recombinant fragment corresponding to Human Thyroid Hormone Receptor beta 1 aa 1-250 (N terminal).
Sequence:MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK NEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSY LDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGK CVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRR REELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDI
Database link: P10828 -
Positive control
- WB: HepG2 and U-87MG cell lysates. Mouse liver and eye tissue lysates. Rat liver and eye tissue lysates. ICC/ IF: U-2 OS.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180612 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 53 kDa.
|
|
ICC/IF |
1/50 - 1/200.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 53 kDa. |
ICC/IF
1/50 - 1/200. |
Target
-
Function
High affinity receptor for triiodothyronine. -
Involvement in disease
Defects in THRB are the cause of generalized thyroid hormone resistance (GTHR) [MIM:188570, 274300]. GTHR is transmitted as an autosomal dominant trait, but an autosomal recessive form also exists. The disease is characterized by goiter, abnormal mental functions, increased susceptibility to infections, abnormal growth and bone maturation, tachycardia and deafness. Affected individuals may also have attention deficit-hyperactivity disorders (ADHD) and language difficulties. GTHR patients also have high levels of circulating thyroid hormones (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH).
Defects in THRB are the cause of selective pituitary thyroid hormone resistance (PRTH) [MIM:145650]; also known as familial hyperthyroidism due to inappropriate thyrotropin secretion. PRTH is a variant form of thyroid hormone resistance and is characterized by clinical hyperthyroidism, with elevated free thyroid hormones, but inappropriately normal serum TSH. Unlike GRTH, where the syndrome usually segregates with a dominant allele, the mode of inheritance in PRTH has not been established. -
Sequence similarities
Belongs to the nuclear hormone receptor family. NR1 subfamily.
Contains 1 nuclear receptor DNA-binding domain. -
Domain
Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 7068 Human
- Entrez Gene: 21834 Mouse
- Entrez Gene: 24831 Rat
- Omim: 190160 Human
- SwissProt: P10828 Human
- SwissProt: P37242 Mouse
- SwissProt: P18113 Rat
- SwissProt: Q28571 Sheep
see all -
Alternative names
- Avian erythroblastic leukemia viral (v erb a) oncogene homolog 2 antibody
- C ERBA 2 antibody
- C ERBA BETA antibody
see all
Images
-
Immunofluorescence staining of U-2 OS cells stained for Thyroid Hormone Receptor beta with ab180612 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).
-
All lanes : Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612) at 1/1000 dilution
Lane 1 : HepG2 cell lysate
Lane 2 : U-87MG cell lysate
Lane 3 : Mouse liver tissue lysate
Lane 4 : Mouse eye tissue lysate
Lane 5 : Rat liver tissue lysate
Lane 6 : Rat eye tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat AntiRabbit IgG (H+L)
Developed using the ECL technique.
Predicted band size: 53 kDa
Exposure time: 30 secondsBlocking buffer: 3% nonfat dry milk in TBST
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab180612 has been referenced in 3 publications.
- Ke S et al. Thyroid hormone receptor β sumoylation is required for thyrotropin regulation and thyroid hormone production. JCI Insight 6:N/A (2021). PubMed: 34237030
- Olichwier A et al. Interplay between Thyroid Hormones and Stearoyl-CoA Desaturase 1 in the Regulation of Lipid Metabolism in the Heart. Int J Mol Sci 22:N/A (2020). PubMed: 33374300
- Howie RN et al. Effects of In Utero Thyroxine Exposure on Murine Cranial Suture Growth. PLoS One 11:e0167805 (2016). IHC-P ; Mouse . PubMed: 27959899