Overview

  • Product name

  • Description

    Rabbit polyclonal to A1BG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Mouse A1BG aa 22-219. N-terminal His-tag and S-tag. Expressed in E. coli.
    Sequence:

    MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS EF-MLDSGSEPKLWAEPQSLLEPWANLTLVCAVDLPTKVFELIQNGWFLS QVRLETQVLSYRFSLGAITSNNSGIYRCRCGVEPPVDIHLPALNKWTMLS NAVEVTGKEPLPRPLAHADPVDWITPGGLPVYVMCQVAMRGVTYLLRQEG VDGVQKPDVQHKGTAGFLIYKPGNYSCSYLTHAAGEPSEPSDIVTIKMYA S


    Database link: Q19LI2

  • Positive control

    • IHC-P: Mouse liver tissue. WB: Recombinant mouse A1BG protein. Mouse liver tissue lysate. Mouse serum. MCF7 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 57 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for A1BG with ab231784 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-A1BG antibody (ab231784) at 2 µg/ml + MCF7 (Human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 57 kDa

  • Anti-A1BG antibody (ab231784) at 2 µg/ml + Mouse serum

    Predicted band size: 57 kDa

  • Anti-A1BG antibody (ab231784) at 2 µg/ml + Mouse liver tissue lysate

    Predicted band size: 57 kDa

  • Anti-A1BG antibody (ab231784) at 2 µg/ml + Recombinant mouse A1BG protein

    Predicted band size: 57 kDa

References

ab231784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up