Overview

  • Product name

  • Description

    Rabbit polyclonal to A1BG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse A1BG aa 313-512. N-terminal His-tag and S-tags (Expressed in E.coli).
    Sequence:

    MWSDETLQAPVLTAEPSSRDLEPGSTVQLRCTAPVSGLRFGLQRQGKPEL VVVQMLNSSGTEAVFELHNISTIDSGNYSCIYMEQAPPFSGSSSSEPVEL RVNGPPPKPRLEALWKSTVHLGQEAIFRCHGHVPRVSMELVREGFKTPFA VASTRSTSAYLKLLFVGPQHAGNYSCRYTALPPFTFESGISDPVEVIVEG


    Database link: Q19LI2

  • Positive control

    • WB: Mouse liver tissue lysate; Recombinant mouse A1BG protein. IHC-P: Mouse liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Plasma.
  • Sequence similarities

    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • A1B antibody
    • A1BG antibody
    • A1BG_HUMAN antibody
    • ABG antibody
    • Alpha 1 B glycoprotein antibody
    • Alpha-1-B glycoprotein antibody
    • Alpha-1B-glycoprotein antibody
    • DKFZp686F0970 antibody
    • Epididymis secretory sperm binding protein Li 163pA antibody
    • GAB antibody
    • HEL S 163pA antibody
    • HYST2477 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for A1BG using ab231805 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-A1BG antibody (ab231805) at 1 µg/ml + Mouse liver lysate
  • Anti-A1BG antibody (ab231805) at 1 µg/ml + Recombinant mouse A1BG protein

    Developed using the ECL technique.

References

ab231805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up