Overview

  • Product name

    Anti-A1BG antibody [D6]
    See all A1BG primary antibodies
  • Description

    Mouse monoclonal [D6] to A1BG
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human A1BG aa 22-206. N-terminal His-Tag. Expressed in E.coli.
    Sequence:

    AIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQLFKNGVAQEPVH LDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWL SMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEAT FPVHQPGNYSCSYRTDGEGALSEPSATVTIEELAA


    Database link: P04217

  • Positive control

    • WB: Recombinant human A1BG protein; Human serum. IHC-P: Human liver and stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    D6
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml.

Target

  • Tissue specificity

    Plasma.
  • Sequence similarities

    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • A1B antibody
    • A1BG antibody
    • A1BG_HUMAN antibody
    • ABG antibody
    • Alpha 1 B glycoprotein antibody
    • Alpha-1-B glycoprotein antibody
    • Alpha-1B-glycoprotein antibody
    • DKFZp686F0970 antibody
    • Epididymis secretory sperm binding protein Li 163pA antibody
    • GAB antibody
    • HEL S 163pA antibody
    • HYST2477 antibody
    see all

Images

  • Anti-A1BG antibody [D6] (ab239588) at 2 µg/ml + Human serum

    Secondary
    HRP-linked Rabbit anti-Mouse IgG at 1/5000 dilution
  • Paraffin-embedded human liver tissue stained for A1BG using ab239588 at 30 μg/ml in immunohistochemical analysis. DAB staining. HRP-linked Goat anti-Mouse polyclonal IgG was used as secondary antibody at 2 μg/ml.

  • Paraffin-embedded human stomach tissue stained for A1BG using ab239588 at 30 μg/ml in immunohistochemical analysis. DAB staining. HRP-linked Goat anti-Mouse polyclonal IgG was used as secondary antibody at 2 μg/ml.

  • Anti-A1BG antibody [D6] (ab239588) at 5 µg/ml + Recombinant human A1BG protein

References

ab239588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up