Overview

  • Product name

  • Description

    Rabbit polyclonal to A1CF/ACF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human A1CF/ACF aa 389-587. Expressed in E. coli. N-terminal tags.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFGAAGVRGLGGRGYL AYTGLGRGYQVKGDKREDKLYDILPGMELTPMNPVTLKPQGIKLAPQILE EICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPK LSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAVPNAT APVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTAR


    Database link: Q9NQ94

  • Positive control

    • IHC-P: Human stomach tissue. WB: Recombinant human A1CF/ACF protein; Pig liver tissue lysate; HeLa, Jurkat and HEK-293T cell lysate.
  • General notes

     This product was previously labelled as A1CF

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml.

Target

  • Function

    Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay.
  • Tissue specificity

    Widely expressed with highest levels in brain, liver, pancreas, colon and spleen.
  • Sequence similarities

    Contains 3 RRM (RNA recognition motif) domains.
  • Domain

    The RRM domains are necessary but not sufficient for binding to APOB mRNA. Additional residues in the pre-RRM and C-terminal regions are required for RNA-binding and for complementing APOBEC1 activity.
  • Cellular localization

    Nucleus. Endoplasmic reticulum. Cytoplasm. Predominantly nuclear where it localizes to heterochromatin. Also cytoplasmic where it is found at the outer surface of the endoplasmic reticulum (By similarity). Shuttles between the nucleus and cytoplasm. May be transported into the nucleus by the nuclear import protein TNPO2/TRN2 or by APOBEC1.
  • Information by UniProt
  • Database links

  • Alternative names

    • A1CF antibody
    • A1CF_HUMAN antibody
    • ACF antibody
    • ACF64 antibody
    • ACF65 antibody
    • Apo B RNA editing protein antibody
    • Apobec 1 complementation factor antibody
    • Apobec 1 complementation factor (ACF) (ASP) antibody
    • APOBEC 1 stimulating protein antibody
    • APOBEC1 complementation factor antibody
    • APOBEC1 stimulating protein antibody
    • APOBEC1-stimulating protein antibody
    • APOBEC1CF antibody
    • ASP antibody
    • MGC163391 antibody
    • RP11-564C4.2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for A1CF/ACF with ab231614 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for A1CF/ACF with ab231614 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-A1CF/ACF antibody (ab231614) at 3 µg/ml

    Lane 1 : Pig liver tissue lysate
    Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : Jurkat (Human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 4 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Anti-A1CF/ACF antibody (ab231614) at 2 µg/ml + Recombinant human A1CF/ACF protein

References

ab231614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up