Anti-A1CF/ACF antibody (ab247053)
Key features and details
- Rabbit polyclonal to A1CF/ACF
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-A1CF/ACF antibody
See all A1CF/ACF primary antibodies -
Description
Rabbit polyclonal to A1CF/ACF -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human A1CF/ACF aa 380-456.
Sequence:REIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPGM ELTPMNPVTLKPQGIKLAPQILEEICQ
Database link: Q9NQ94 -
Positive control
- IHC-P: Human kidney, colon and liver tissue. ICC/IF: Caco-2 cells.
-
General notes
This product was previously labelled as A1CF
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab247053 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay. -
Tissue specificity
Widely expressed with highest levels in brain, liver, pancreas, colon and spleen. -
Sequence similarities
Contains 3 RRM (RNA recognition motif) domains. -
Domain
The RRM domains are necessary but not sufficient for binding to APOB mRNA. Additional residues in the pre-RRM and C-terminal regions are required for RNA-binding and for complementing APOBEC1 activity. -
Cellular localization
Nucleus. Endoplasmic reticulum. Cytoplasm. Predominantly nuclear where it localizes to heterochromatin. Also cytoplasmic where it is found at the outer surface of the endoplasmic reticulum (By similarity). Shuttles between the nucleus and cytoplasm. May be transported into the nucleus by the nuclear import protein TNPO2/TRN2 or by APOBEC1. - Information by UniProt
-
Database links
- Entrez Gene: 29974 Human
- SwissProt: Q9NQ94 Human
- Unigene: 282795 Human
-
Alternative names
- A1CF antibody
- A1CF_HUMAN antibody
- ACF antibody
see all
Images
-
PFA fixed, Triton X-100 permeabilized Caco-2 (Human colorectal adenocarcinoma cell line) cells labeling A1CF/ACF using ab247053 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-A1CF/ACF antibody (ab247053)
Paraffin-embedded human liver tissue stained for A1CF/ACF using ab247053 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-A1CF/ACF antibody (ab247053)
Paraffin-embedded human colon tissue stained for A1CF/ACF using ab247053 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-A1CF/ACF antibody (ab247053)
Paraffin-embedded human kidney tissue stained for A1CF/ACF using ab247053 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-A1CF/ACF antibody (ab247053)
Paraffin-embedded human tonsil tissue stained for A1CF/ACF using ab247053 at 1/200 dilution in immunohistochemical analysis. No positivity as expected.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247053 has not yet been referenced specifically in any publications.