Anti-A1CF/ACF antibody (ab247053)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-A1CF/ACF antibody
See all A1CF/ACF primary antibodies -
Description
Rabbit polyclonal to A1CF/ACF -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human A1CF/ACF aa 380-456.
Sequence:REIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPGM ELTPMNPVTLKPQGIKLAPQILEEICQ
Database link: Q9NQ94 -
Positive control
- IHC-P: Human kidney, colon and liver tissue. ICC/IF: Caco-2 cells.
-
General notes
This product was previously labelled as A1CF
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab247053 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay. -
Tissue specificity
Widely expressed with highest levels in brain, liver, pancreas, colon and spleen. -
Sequence similarities
Contains 3 RRM (RNA recognition motif) domains. -
Domain
The RRM domains are necessary but not sufficient for binding to APOB mRNA. Additional residues in the pre-RRM and C-terminal regions are required for RNA-binding and for complementing APOBEC1 activity. -
Cellular localization
Nucleus. Endoplasmic reticulum. Cytoplasm. Predominantly nuclear where it localizes to heterochromatin. Also cytoplasmic where it is found at the outer surface of the endoplasmic reticulum (By similarity). Shuttles between the nucleus and cytoplasm. May be transported into the nucleus by the nuclear import protein TNPO2/TRN2 or by APOBEC1. - Information by UniProt
-
Database links
- Entrez Gene: 29974 Human
- SwissProt: Q9NQ94 Human
- Unigene: 282795 Human
-
Alternative names
- A1CF antibody
- A1CF_HUMAN antibody
- ACF antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-A1CF/ACF antibody (ab247053)PFA fixed, Triton X-100 permeabilized Caco-2 (Human colorectal adenocarcinoma cell line) cells labeling A1CF/ACF using ab247053 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-A1CF/ACF antibody (ab247053)Paraffin-embedded human liver tissue stained for A1CF/ACF using ab247053 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-A1CF/ACF antibody (ab247053)Paraffin-embedded human colon tissue stained for A1CF/ACF using ab247053 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-A1CF/ACF antibody (ab247053)Paraffin-embedded human kidney tissue stained for A1CF/ACF using ab247053 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-A1CF/ACF antibody (ab247053)Paraffin-embedded human tonsil tissue stained for A1CF/ACF using ab247053 at 1/200 dilution in immunohistochemical analysis. No positivity as expected.
Datasheets and documents
References
ab247053 has not yet been referenced specifically in any publications.
