Overview

  • Product name

  • Description

    Rabbit polyclonal to A4GALT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human A4GALT aa 290-340 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    QDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHA R


    Database link: Q9NPC4

  • Positive control

    • Human placenta and kidney tissues

Properties

Applications

Our Abpromise guarantee covers the use of ab203681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

Target

  • Function

    Necessary for the biosynthesis of the Pk antigen of blood histogroup P. Catalyzes the transfer of galactose to lactosylceramide and galactosylceramide. Necessary for the synthesis of the receptor for bacterial verotoxins.
  • Tissue specificity

    Ubiquitous. Highly expressed in kidney, heart, spleen, liver, testis and placenta.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 32 family.
  • Domain

    The conserved DXD motif is involved in enzyme activity.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 N acetylglucosaminyltransferase antibody
    • 4-galactosyltransferase antibody
    • 4-N-acetylglucosaminyltransferase antibody
    • A14GALT antibody
    • A4GALT antibody
    • A4GALT1 antibody
    • A4GAT_HUMAN antibody
    • Alpha 1 4 galactosyltransferase antibody
    • Alpha 1 4 N acetylglucosaminyltransferase antibody
    • Alpha-1 antibody
    • Alpha4Gal T1 antibody
    • Alpha4Gal-T1 antibody
    • CD77 synthase antibody
    • Gb3 synthase antibody
    • Gb3S antibody
    • Globotriaosylceramide synthase antibody
    • Lactosylceramide 4 alpha galactosyltransferase antibody
    • Lactosylceramide 4-alpha-galactosyltransferase antibody
    • P blood group (P one antigen) antibody
    • P(k) antigen synthase antibody
    • P1 antibody
    • P1/Pk synthase antibody
    • PK antibody
    • UDP galactose beta D galactosyl beta1 R 4 alpha D galactosyltransferase antibody
    • UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling A4GALT using ab203681 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue labeling A4GALT using ab203681 at 1/200 dilution.

References

ab203681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up