Overview

  • Product name

    Anti-AACT antibody [5G3C11] - C-terminal
    See all AACT primary antibodies
  • Description

    Mouse monoclonal [5G3C11] to AACT - C-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human AACT aa 279-423 (C terminal).
    Sequence:

    PDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDIL LQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEASAATAV KITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA


    Database link: P01011

  • Positive control

    • Human AACT (AA: 279-432) recombinant protein, AACT (AA: 279-432)-hIgGFc transfected HEK293 cell lysate, A549 cell lysate, A549 cells, Human endometrial cancer tissues, Human cancer tissues

Properties

Applications

Our Abpromise guarantee covers the use of ab201987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 47 kDa.

Target

  • Function

    Although its physiological function is unclear, it can inhibit neutrophil cathepsin G and mast cell chymase, both of which can convert angiotensin-1 to the active angiotensin-2.
  • Tissue specificity

    Plasma. Synthesized in the liver. Like the related alpha-1-antitrypsin, its concentration increases in the acute phase of inflammation or infection. Found in the amyloid plaques from the hippocampus of Alzheimer disease brains.
  • Involvement in disease

    Defects in SERPINA3 may be a cause of chronic obstructive pulmonary disease (COPD) [MIM:107280].
  • Sequence similarities

    Belongs to the serpin family.
  • Domain

    The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • SERPINA3 antibody
    • AACT antibody
    • AACT_HUMAN antibody
    • ACT antibody
    • alpha 1 Antichymotrypsin antibody
    • Alpha-1-antichymotrypsin His-Pro-less antibody
    • Antichymotrypsin antibody
    • Cell growth inhibiting gene 24/25 protein antibody
    • Cell growth-inhibiting gene 24/25 protein antibody
    • GIG24 antibody
    • GIG25 antibody
    • Growth inhibiting protein 24 antibody
    • Growth inhibiting protein 25 antibody
    • MGC88254 antibody
    • Serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase, antitrypsin) member 3 antibody
    • Serine (or cysteine) proteinase inhibitor clade A member 3 antibody
    • Serine proteinase inhibitor clade A member 3 antibody
    • Serpin A3 antibody
    • Serpin family A member 3 antibody
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 3 antibody
    • SERPINA3 antibody
    see all

Images

  • Anti-AACT antibody [5G3C11] - C-terminal (ab201987) at 1/500 dilution + A549 cell lysate

    Predicted band size: 47 kDa

  • Immunohistochemical analysis of paraffin-embedded Human bladder cancer tissue labeling AACT with ab201987 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human endometrial cancer tissue labeling AACT with ab201987 at 1/200 dilution.

  • Flow cytometric analysis of A549 cells using ab201987 at 1/200 dilution (green) and negative control (red).

  • All lanes : Anti-AACT antibody [5G3C11] - C-terminal (ab201987) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : AACT (AA: 279-432)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 47 kDa

  • Anti-AACT antibody [5G3C11] - C-terminal (ab201987) at 1/500 dilution + AACT (AA: 279-432) recombinant protein

    Predicted band size: 47 kDa

References

ab201987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
ELISA
Sample
Human Serum (secretome)
Specification
secretome
Blocking step
BSA as blocking agent for 15 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 4°C
Type
Sandwich (Detection)

Dr. Marcia Ivonne Pena Paz

Verified customer

Submitted Feb 05 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up