Anti-AADAC/DAC antibody (ab214184)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AADAC/DAC antibody (ab214184)

    Key features and details

    • Rabbit polyclonal to AADAC/DAC
    • Suitable for: IHC-P
    • Reacts with: Human
    • Isotype: IgG

    Overview

    • Product name

      Anti-AADAC/DAC antibody

    • Description

      Rabbit polyclonal to AADAC/DAC

    • Host species

      Rabbit

    • Tested applications

      Suitable for: IHC-Pmore details

    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat

    • Immunogen

      Synthetic peptide within Human AADAC/DAC aa 230-280 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
      Sequence:

      PSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFK F


      Database link: P22760
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • IHC-P: Human colon carcinoma tissue.

    • General notes

       This product was previously labelled as AADAC

       

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    Applications

    Our Abpromise guarantee covers the use of ab214184 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    Target

    • Function

      Arylacetamide deacetylation is an important enzyme activity in the metabolic activation of arylamine substrates to ultimate carcinogens. Displays major serine hydrolase activity in liver microsomes. Hydrolyzes also flutamide, which is an antiandrogen drug used for the treatment of prostate cancer that occasionaly causes severe hepatotoxicity. Displays cellular triglyceride lipase activity in liver. Increases intracellular fatty acids derived from hydrolysis of newly formed triglyceride stores.

    • Tissue specificity

      Mainly expressed in liver, small intestine, colon and adrenal gland.

    • Sequence similarities

      Belongs to the 'GDXG' lipolytic enzyme family.

    • Cellular localization

      Endoplasmic reticulum membrane. Microsome membrane.
    • Information by UniProt

    • Database links

      see all

    • Alternative names

      • AAAD_HUMAN antibody
      • Aada antibody
      • Aadac antibody
      • Arylacetamide deacetylase (esterase) antibody
      • Arylacetamide deacetylase antibody
      • CES5A1 antibody
      • DAC antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AADAC/DAC antibody (ab214184)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AADAC/DAC antibody (ab214184)

      Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human colon carcinoma tissue sections labeling AADAC/DAC using ab214184 at a 1/200 dilution. DAB staining.

    References (0)

    Publishing research using ab214184? Please let us know so that we can cite the reference in this datasheet.

    ab214184 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab214184.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com