Anti-AADAC/DAC antibody (ab214184)
Key features and details
- Rabbit polyclonal to AADAC/DAC
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-AADAC/DAC antibody -
Description
Rabbit polyclonal to AADAC/DAC -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Synthetic peptide within Human AADAC/DAC aa 230-280 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:PSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFK F
Database link: P22760 -
Positive control
- IHC-P: Human colon carcinoma tissue.
-
General notes
This product was previously labelled as AADAC
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab214184 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Arylacetamide deacetylation is an important enzyme activity in the metabolic activation of arylamine substrates to ultimate carcinogens. Displays major serine hydrolase activity in liver microsomes. Hydrolyzes also flutamide, which is an antiandrogen drug used for the treatment of prostate cancer that occasionaly causes severe hepatotoxicity. Displays cellular triglyceride lipase activity in liver. Increases intracellular fatty acids derived from hydrolysis of newly formed triglyceride stores. -
Tissue specificity
Mainly expressed in liver, small intestine, colon and adrenal gland. -
Sequence similarities
Belongs to the 'GDXG' lipolytic enzyme family. -
Cellular localization
Endoplasmic reticulum membrane. Microsome membrane. - Information by UniProt
-
Database links
- Entrez Gene: 13 Human
- Entrez Gene: 67758 Mouse
- Entrez Gene: 57300 Rat
- Omim: 600338 Human
- SwissProt: P22760 Human
- SwissProt: Q99PG0 Mouse
- SwissProt: Q9QZH8 Rat
- Unigene: 506908 Human
see all -
Alternative names
- AAAD_HUMAN antibody
- Aada antibody
- Aadac antibody
see all
Images
Datasheets and documents
References (0)
ab214184 has not yet been referenced specifically in any publications.