Overview

  • Product name

  • Description

    Rabbit polyclonal to AADACL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human AADACL1 aa 218-350.
    Sequence:

    ALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMI VNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELP QLLDARSAPLIADQAVLQLLPKTYILTCEHDVL


    Database link: Q6PIU2

  • Positive control

    • IHC-P: Human hippocampus tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. May be responsible for cholesterol ester hydrolysis in macrophages, thereby contributing to the development of atherosclerosis. Also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds. May contribute to cancer pathogenesis by promoting tumor cell migration.
  • Tissue specificity

    Expressed in monocyte-derived macrophages. Up-regulated in invasive melanoma and breast carcinoma cell lines.
  • Sequence similarities

    Belongs to the 'GDXG' lipolytic enzyme family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane. Microsome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Arylacetamide deacetylase like 1 antibody
    • Arylacetamide deacetylase-like 1 antibody
    • NCEH antibody
    • Nceh1 antibody
    • NCEH1_HUMAN antibody
    • Neutral cholesterol ester hydrolase 1 antibody
    • Neutral cholesterol ester hydrolase antibody
    see all

Images

  • Paraffin-embedded human hippocampus tissue stained for AADACL1 using ab224127 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for AADACL1 (green) using ab224127 at 4 µg/ml in ICC/IF.

References

ab224127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up