Overview

  • Product name

    Anti-AASDHPPT antibody
  • Description

    Rabbit polyclonal to AASDHPPT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human AASDHPPT aa 1-309.
    Sequence:

    MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQ FVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSN PYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKR KFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEF DLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDG SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE IPIRNGTKS


    Database link: Q9NRN7-1

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 36 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN.
  • Tissue specificity

    Detected in heart, skeletal muscle, placenta, testis, brain, pancreas, liver and kidney.
  • Sequence similarities

    Belongs to the P-Pant transferase superfamily. AcpS family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4' phosphopantetheinyl transferase antibody
    • 4'-phosphopantetheinyl transferase antibody
    • AASD PPT antibody
    • AASD-PPT antibody
    • AASDHPPT antibody
    • ADPPT_HUMAN antibody
    • Alpha aminoadipic semialdehyde dehydrogenase phosphopantetheinyl transferase antibody
    • Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase antibody
    • CGI 80 antibody
    • HAH P antibody
    • L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase antibody
    • LYS2 antibody
    • LYS5 antibody
    • LYS5 ortholog antibody
    see all

Images

  • Anti-AASDHPPT antibody (ab235376) at 1/200 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 36 kDa

  • Paraffin-embedded human testis tissue stained for AASDHPPT with ab235376 at 1/100 dilution in immunohistochemical analysis.

References

ab235376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up