Overview

  • Product name

    Anti-AATF/DED antibody [3C7]
    See all AATF/DED primary antibodies
  • Description

    Mouse monoclonal [3C7] to AATF/DED
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human AATF/DED aa 151-250. NCBI Accession No. AAH00591.
    Sequence:

    VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGD RNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT


    Database link: Q9NY61

  • Positive control

    • Human kidney tissue; HeLa cells; HeLa cell lysate.
  • General notes

     This product was previously labelled as AATF

     

Properties

Applications

Our Abpromise guarantee covers the use of ab219073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 10 µg/ml.
WB Use at an assay dependent concentration. Predicted molecular weight: 63 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dementia), although the molecular basis for this phenomenon has not been described to date.
  • Tissue specificity

    Ubiquitously expressed. Expressed at high levels in brain, heart, kidney, placenta and thymus.
  • Sequence similarities

    Belongs to the AATF family.
  • Post-translational
    modifications

    Hyperphosphorylated during the G1/S phase transition.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AATF antibody
    • AATF_HUMAN antibody
    • Apoptosis antagonizing transcription factor antibody
    • Apoptosis-antagonizing transcription factor antibody
    • BFR2 antibody
    • CHE 1 antibody
    • CHE1 antibody
    • DED antibody
    • Protein AATF antibody
    • Rb binding protein Che 1 antibody
    • Rb-binding protein Che-1 antibody
    see all

Images

  • Immunofluorescent analysis of HeLa cells labeling AATF/DED using ab219073 at 10 µg/mL.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling AATF/DED using ab219073 at 10 µg/ml.

  • Anti-AATF/DED antibody [3C7] (ab219073) + HeLa cell lysate

    Predicted band size: 63 kDa

References

ab219073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up