Anti-Proteasome 20S C2/HC2 antibody (ab140499)
Key features and details
- Rabbit polyclonal to Proteasome 20S C2/HC2
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Proteasome 20S C2/HC2 antibody
See all Proteasome 20S C2/HC2 primary antibodies -
Description
Rabbit polyclonal to Proteasome 20S C2/HC2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide corresponding to Human Proteasome 20S C2/HC2 aa 213-263.
Sequence:GIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPME H
Database link: P25786 -
Positive control
- WB: 293T, HeLa, Jurkat whole cell lysates. IP: 293T cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH: 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab140499 was affinity purified using an epitope specific to Proteasome 20S C2/HC2 immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab140499 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 30 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 30 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Function
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome (By similarity). Might be involved in the anti-inflammatory response of macrophages during the interaction with C.albicans heat-inactivated cells. -
Sequence similarities
Belongs to the peptidase T1A family. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 451040 Chimpanzee
- Entrez Gene: 515503 Cow
- Entrez Gene: 476867 Dog
- Entrez Gene: 100056224 Horse
- Entrez Gene: 5682 Human
- Entrez Gene: 100171670 Orangutan
- Entrez Gene: 701029 Rhesus monkey
- Omim: 602854 Human
see all -
Alternative names
- 30 kDa prosomal protein antibody
- HC 2 antibody
- HC2 antibody
see all
Images
-
All lanes : Anti-Proteasome 20S C2/HC2 antibody (ab140499) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 30 kDa
Exposure time: 30 seconds -
ab140499 at 1 µg/ml detecting Proteasome 20S C2/HC2 in 293T whole cell lysate by WB following IP.
Lane 1: ab140499 at 6µg/mg of lysate.
Lane 2: Control IgG.
In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded. Detection: Chemiluminescence with an exposure time of 30 seconds.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab140499 has been referenced in 3 publications.
- Abou Karam P et al. Malaria parasites release vesicle subpopulations with signatures of different destinations. EMBO Rep 23:e54755 (2022). PubMed: 35642585
- Dekel E et al. 20S proteasomes secreted by the malaria parasite promote its growth. Nat Commun 12:1172 (2021). PubMed: 33608523
- Olshina MA et al. Regulation of the 20S Proteasome by a Novel Family of Inhibitory Proteins. Antioxid Redox Signal 32:636-655 (2020). PubMed: 31903784