Recombinant Human Mint3 protein (ab153767)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human Mint3 protein -
Purity
> 95 % SDS-PAGE.
Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRM ELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAH GLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRL -
Predicted molecular weight
15 kDa -
Amino acids
1 to 138 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab153767 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C.
pH: 7.20
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.
General Info
-
Alternative names
- Adapter protein X11gamma
- amyloid beta (A4) precursor protein binding, family A, member 3
- Amyloid beta A4 precursor protein-binding family A member 3
see all -
Function
May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP. May enhance the activity of HIF1A in macrophages by inhibiting the activity of HIF1AN. -
Tissue specificity
Expressed in all tissues examined with lower levels in brain and testis. -
Sequence similarities
Contains 2 PDZ (DHR) domains.
Contains 1 PID domain. -
Domain
Composed of an N-terminal domain, a middle phosphotyrosine-binding domain (PID/PTB) that mediates binding with the cytoplasmic domain of the beta-amyloid precursor protein, and two C-terminal PDZ domains thought to attach proteins to the plasma membrane. -
Cellular localization
Cytoplasm > perinuclear region. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab153767 has not yet been referenced specifically in any publications.