Anti-KPNA4 antibody (ab176585)
Key features and details
- Rabbit polyclonal to KPNA4
- Suitable for: WB, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-KPNA4 antibody
See all KPNA4 primary antibodies -
Description
Rabbit polyclonal to KPNA4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Horse, Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan -
Immunogen
Synthetic peptide within Human KPNA4 aa 471-521 (C terminal). The exact sequence is proprietary. (NP_002259.1).
Sequence:EDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQ F
Database link: O00629 -
Positive control
- HeLa and 293T whole cell lysates; Human Ovarian Carcinoma and Prostate Carcinoma tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176585 was affinity purified using an epitope specific to KPNA4 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176585 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 57 kDa.
|
|
IP |
Use at 2-5 µg/mg of lysate.
|
|
IHC-P |
1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 57 kDa. |
IP
Use at 2-5 µg/mg of lysate. |
IHC-P
1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. -
Tissue specificity
Highly expressed in testis, ovary, small intestine, heart, skeletal muscle, lung and pancreas, but barely detectable in kidney, thymus, colon and peripheral blood leukocytes. -
Sequence similarities
Belongs to the importin alpha family.
Contains 10 ARM repeats.
Contains 1 IBB domain. -
Domain
Consists of an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. The N-terminal hydrophilic region contains the importin beta binding domain (IBB domain), which is sufficient for binding importin beta and essential for nuclear protein import.
The IBB domain is thought to act as an intrasteric autoregulatory sequence by interacting with the internal autoinhibitory NLS. Binding of KPNB1 probably overlaps the internal NLS and contributes to a high affinity for cytoplasmic NLS-containing cargo substrates. After dissociation of the importin/substrate complex in the nucleus the internal autohibitory NLS contributes to a low affinity for nuclear NLS-containing proteins.
The major and minor NLS binding sites are mainly involved in recognition of simple or bipartite NLS motifs. Structurally located within in a helical surface groove they contain several conserved Trp and Asn residues of the corresponding third helices (H3) of ARM repeats which mainly contribute to binding. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 470982 Chimpanzee
- Entrez Gene: 100757318 Chinese hamster
- Entrez Gene: 535090 Cow
- Entrez Gene: 478680 Dog
- Entrez Gene: 3840 Human
- Entrez Gene: 100171548 Orangutan
- Entrez Gene: 100349259 Rabbit
- Entrez Gene: 702486 Rhesus monkey
see all -
Alternative names
- FLJ31113 antibody
- IMA3_HUMAN antibody
- Importin alpha 3 antibody
see all
Images
-
All lanes : Anti-KPNA4 antibody (ab176585) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa
Exposure time: 3 seconds -
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate carcinoma tissue labeling KPNA4 with ab176585 at 1µg/ml.
-
Detection of KPNA4 in Immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176585 at 3 µg/mg lysate for IP (Lane 1). For WB detection ab176585 was used at 0.4 µg/ml. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 0.5 seconds.
Protocols
Datasheets and documents
-
Datasheet download
References (2)
ab176585 has been referenced in 2 publications.
- Ping X et al. KPNA4 is involved in cataract formation via the nuclear import of p53. Gene 786:145621 (2021). PubMed: 33798680
- Sun B et al. Citrullination of NF-?B p65 promotes its nuclear localization and TLR-induced expression of IL-1ß and TNFa. Sci Immunol 2:N/A (2017). PubMed: 28783661