Recombinant human CD47 protein (Fc Chimera Active) (ab220587)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE, Flow Cyt
Description
-
Product name
Recombinant human CD47 protein (Fc Chimera Active)
See all CD47 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized ab220587 at 2 μg/mL (100 μL/well) can bind Human SIRP alpha, His Tag with a linear range of 0.016-0.5 μg/mL.
-
Purity
> 95 % SDS-PAGE.
>90% as determined by SEC-MALS. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTF DGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTE LTREGETIIELKYRVVSWFSP -
Predicted molecular weight
40 kDa including tags -
Amino acids
19 to 139 -
Tags
Fc tag C-Terminus -
Additional sequence information
Fused with a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus (NP_942088).
-
Specifications
Our Abpromise guarantee covers the use of ab220587 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
Flow Cytometry
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 1 mg/ml.
General Info
-
Alternative names
- Antigen identified by monoclonal antibody 1D8
- Antigenic surface determinant protein OA3
- CD 47
see all -
Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. -
Tissue specificity
Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
Human CD47 (Fc Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Immobilized ab220587 at 2 μg/mL (100 μL/well) can bind Human SIRP alpha, His Tag (HPLC-verified) with a linear range of 0.016-0.5 μg/mL.
-
Serial dilutions of Anti-Human CD47 Neutralizing Antibody were added into Human CD47, Fc Tag (HPLC-verified) (ab220587): Biotinylated Human SIRP alpha, Fc,Avitag (ab246052) binding reactions. The half maximal inhibitory concentration (IC50) is 0.5431 μg/mL
-
Loaded Recombinant human CD47 protein (Fc Chimera Active) (ab220587) on Protein A Biosensor, can bind Human SIRP alpha, His Tag (HPLC-verified) (ab174006) with an affinity constant of 1.1 μM as determined in BLI assay
-
FACS assay shows that ab220587 can bind to ACHN cell expressing SIRP-a. The concentration of CD47 used is 10 μg/mL.
-
FACS analysis shows that the binding of Human CD47 to ACHN expressing SIRP-a was inhibited by increasing concentration of neutralizing SIRP-a antibody. The concentration of Human CD47 used is 10 μg/mL. IC50=8.39 μg/mL
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab220587 has not yet been referenced specifically in any publications.