Recombinant Mouse C5 protein (ab283428)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% HPLC
- Endotoxin level: <= 0.005 Eu/µg
- Suitable for: MS, HPLC, SDS-PAGE
Description
-
Product name
Recombinant Mouse C5 protein -
Purity
>= 95 % HPLC.
=95% Purity determined by HPLC and SDS-PAGE -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Mouse -
Sequence
NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLC IRAFNECCTIANKIRKESPHKPVQLGR -
Predicted molecular weight
9 kDa -
Amino acids
679 to 755 -
Additional sequence information
N-terminal glycine
-
-
Description
Recombinant Mouse C5 / C5a protein
Specifications
Our Abpromise guarantee covers the use of ab283428 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Mass Spectrometry
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose -
ReconstitutionReconstitute with Phosphate Buffered Saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- Anaphylatoxin C5a analog
- C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
- C5
see all -
Function
Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.
Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. C5a also stimulates the locomotion of polymorphonuclear leukocytes (chemokinesis) and direct their migration toward sites of inflammation (chemotaxis). -
Involvement in disease
Complement component 5 deficiency
An association study of C5 haplotypes and genotypes in individuals with chronic hepatitis C virus infection shows that individuals homozygous for the C5_1 haplotype have a significantly higher stage of liver fibrosis than individuals carrying at least 1 other allele (PubMed:15995705). -
Sequence similarities
Contains 1 anaphylatoxin-like domain.
Contains 1 NTR domain. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab283428 has not yet been referenced specifically in any publications.