Recombinant Human CXCL11 Protein (Active) (ab283901)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% HPLC
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, MS
Description
-
Product name
Recombinant Human CXCL11 Protein (Active)
See all CXCL11 proteins and peptides -
Biological activity
Fully biologically active determined by dose dependent cell migration of human KHYG-1 cells. ED50 for this effect is ≤4.2 ng/ml corresponding to specific activity of 2.38x105 units/mg.
-
Purity
>= 95 % HPLC.
>= 95 % SDS-PAGE. -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKG QRCLNPKSKQARLIIKKVERKNF -
Predicted molecular weight
8 kDa -
Actual molecular weight
8 kDa -
Molecular weight information
Mass determination by ESI-TOF. Predicted MW is 8364.06 Da (+/- 10 Da by ESI-TOF). Observed MW is 8363.33 -
Amino acids
22 to 94 -
Additional sequence information
N-terminal glycine. Full length mature chain without signal peptide.
-
Specifications
Our Abpromise guarantee covers the use of ab283901 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
Mass Spectrometry
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.40
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with phosphate buffered saline. Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white power. This variance does not affect the quality of the product.
General Info
-
Alternative names
- b R1
- b-R1
- Beta-R1
see all -
Function
Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. -
Tissue specificity
High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Fully biologically active determined by dose dependent cell migration of human KHYG-1 cells. ED50 for this effect is ≤4.2 ng/ml corresponding to specific activity of 2.38x105 units/mg.
Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.
Lot GR3415973-2
-
SDS-PAGE analysis of ab283901
-
Mass determination by ESI-TOF.
Predicted MW is 8364.06 Da (+/- 10 Da by ESI-TOF). Observed MW is 8363.33
-
HPLC analysis of ab283901
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab283901 has not yet been referenced specifically in any publications.