Recombinant human IL-10 protein (Active) (ab284660)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% HPLC
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: HPLC, MS, SDS-PAGE, Biological Activity, Functional Studies
Description
-
Product name
Recombinant human IL-10 protein (Active)
See all IL-10 proteins and peptides -
Biological activity
Fully biologically active determined by dose dependent proliferation of MC/9 cells. ED50 is ≤2.759 ng/mL, corresponding to a specific activity of 3.63 x 105 units/mg
-
Purity
>= 95 % HPLC. -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKE SLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKT LRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYI EAYMTMKIRN -
Actual molecular weight
19 kDa -
Amino acids
19 to 178
-
Specifications
Our Abpromise guarantee covers the use of ab284660 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
Mass Spectrometry
SDS-PAGE
Biological Activity
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw.Lyophilized contents may appear as either a translucent film or a white power. This variance does not affect the quality of the product. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- CSIF
- Cytokine synthesis inhibitory factor
- GVHDS
see all -
Function
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. -
Tissue specificity
Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types. -
Sequence similarities
Belongs to the IL-10 family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Fully biologically active determined by dose dependent proliferation of MC/9 cells. ED50 is ≤2.759 ng/mL, corresponding to a specific activity of 3.63 x 105 units/mg
-
SDS-page analysis of ab284660
-
Mass determination by ESI-TOF.
Predicted MW is 18647.43 Da (+/- 10 Da by ESI-TOF). Observed MW is 18648.85 Da.
-
HPLC analysis of ab284660
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab284660 has not yet been referenced specifically in any publications.