Recombinant human GDF15 protein (ab50077)
Key features and details
- Expression system: CHO cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human GDF15 protein
See all GDF15 proteins and peptides -
Biological activity
Determined by its ability to inhibit alkaline phosphatase activity in differentiating MC3T3/E1 osetoblast cells. The expected ED50 for this effect is 75-200 ng/ml.
-
Purity
> 95 % SDS-PAGE.
ab50077 purity was determined also by HPLC -
Endotoxin level
< 1.000 Eu/µg -
Expression system
CHO cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPS QFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQT YDDLLAKDCHCI -
Predicted molecular weight
25 kDa -
Actual molecular weight
25 kDa -
Amino acids
197 to 308 -
Additional sequence information
This product refers to the processed mature form of this protein from aa 195 to 308. Therefore it does not contain the signal peptide or propeptide.
-
Specifications
Our Abpromise guarantee covers the use of ab50077 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Molecular Weight: 24.6 kDa
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute to 1mg/ml with distilled water.
General Info
-
Alternative names
- GDF 15
- GDF-15
- Gdf15
see all -
Tissue specificity
Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab50077 has been referenced in 3 publications.
- Radwanska A et al. Increased expression and accumulation of GDF15 in IPF extracellular matrix contribute to fibrosis. JCI Insight 7:N/A (2022). PubMed: 35993367
- Shao M et al. Artemisinin analog SM934 alleviates epithelial barrier dysfunction via inhibiting apoptosis and caspase-1-mediated pyroptosis in experimental colitis. Front Pharmacol 13:849014 (2022). PubMed: 36120344
- Hao T et al. LINC-PINT suppresses tumour cell proliferation, migration and invasion through targeting miR-374a-5p in ovarian cancer. Cell Biochem Funct 38:1089-1099 (2020). PubMed: 32638404