Native human Cathepsin D protein (ab91123)
Key features and details
- Expression system: Native
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, WB
Description
-
Product name
Native human Cathepsin D protein
See all Cathepsin D proteins and peptides -
Biological activity
Activity: >=300 units per mg protein. One unit is defined as the amount of enzyme that digests hemoglobin-releasing peptides which are soluble in 10% TCA. The reaction is measured by an increase of an A280 of 1.0 per 60 minutes at 37°C . Substrate: acid denatured hemoglobin, pH 1.8 (0.2% in reaction mixture). Buffer: 100 mM formate, pH 3.3. -
Purity
> 95 % SDS-PAGE. -
Expression system
Native -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Native -
-
Species
Human -
Sequence
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKG PVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGS SNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGY LSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILG MAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT DSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLS PEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRD NNRVGFAEAARL -
Predicted molecular weight
42 kDa -
Additional sequence information
Source: Human Plasma
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab91123 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
Western blot
-
Form
Lyophilized -
Additional notes
Lyophilized from 2 mM Na phosphate, pH 6.5.
Protein Determination: Extinction Coefficient (E) 0.1% at 280nm, 1cm pathway = 1.0 Prepared from tissue shown to be non reactive for HBsAg, anti-HCV, anti-HBc, and negative for anti-HIV 1 & 2 by FDA approved tests.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C.
pH: 6.50
Constituent: 0.0328% Sodium phosphateThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionResuspend a 25ug vial with 71.4uL of deionized H2O to give a protein concentration of 0.350mg/mL, which is the original protein concentration of the lot when it was finished. This should then be aliquotted into suitable amounts in a screw top vial to prevent sublimation and stored at <70 deg C. Aliquots should be diluted to appropriate concentration once thawed. We recommend 2mM NaP pH 6.5 to make dilutions.
General Info
-
Alternative names
- CatD
- CATD_HUMAN
- Cathepsin D
see all -
Function
Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. -
Tissue specificity
Expressed in the aorta extrcellular space (at protein level). -
Involvement in disease
Ceroid lipofuscinosis, neuronal, 10 -
Sequence similarities
Belongs to the peptidase A1 family.
Contains 1 peptidase A1 domain. -
Post-translational
modificationsN- and O-glycosylated. -
Cellular localization
Lysosome. Melanosome. Secreted, extracellular space. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. In aortic samples, detected as an extracellular protein loosely bound to the matrix (PubMed:20551380). - Information by UniProt
Images
-
SDS-PAGE: 4-12% Bis-Tris NuPAGE gel
Lane 1. Molecular weight markers
Lane 2. 4 μg Cathepsin D (non-reduced/no heat)
Lane 3. 7 μg Cathepsin D (non-reduced/no heat)
Lane 4. Molecular weight markers
Lane 5. 4 μg Cathepsin D (reduced/heated)
Lane 6. 7 μg Cathepsin D (reduced/heated)
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab91123 has been referenced in 1 publication.
- Brings S et al. Urinary cathepsin L is predictive of changes in albuminuria and correlates with glucosepane in patients with type 2 diabetes in a closed-cohort study. J Diabetes Complications N/A:107648 (2020). PubMed: 32532588