Recombinant rat RANTES protein (ab9784)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
Description
-
Product name
Recombinant rat RANTES protein
See all RANTES proteins and peptides -
Purity
> 98 % SDS-PAGE.
Sterile filtered Greater than 98% pure by HPLC analyses. Endotoxin level is less than 0.1 ng per g (1EU/g). -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVC ANPEKKWVQEYINYLEMS -
Predicted molecular weight
10 kDa -
Amino acids
25 to 92
-
Specifications
Our Abpromise guarantee covers the use of ab9784 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Form
Lyophilized -
Additional notes
The biological activity of this product is determined by its ability to chemoattract rat peritoneal macrophages using a concentration of 50.0-100.0 ng/ml. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- Beta chemokine RANTES
- Beta chemokine RANTES precursor
- C C motif chemokine 5
see all -
Function
Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. -
Tissue specificity
T-cell and macrophage specific. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsN-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.
The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab9784 has been referenced in 1 publication.
- Kanaya A et al. Chronic allergic lung inflammation negatively influences neurobehavioral outcomes in mice. J Neuroinflammation 19:210 (2022). PubMed: 36045388