Overview

  • Product name

  • Description

    Rabbit polyclonal to ABCB11/BSEP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Mouse ABCB11/BSEP aa 1-50 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MSDSVILRSVKKFGEENHAFESDGFHNNDKKSRLQDKKKGEGARVGFFEL


    Database link: Q9QY30

  • Positive control

    • Rat pancreatic and human liver carcinoma tissues.
  • General notes

     This product was previously labelled as ABCB11

     

Properties

Applications

Our Abpromise guarantee covers the use of ab217532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Involved in the ATP-dependent secretion of bile salts into the canaliculus of hepatocytes.
  • Tissue specificity

    Expressed predominantly, if not exclusively in the liver, where it was further localized to the canalicular microvilli and to subcanalicular vesicles of the hepatocytes by in situ.
  • Involvement in disease

    Defects in ABCB11 are the cause of progressive familial intrahepatic cholestasis type 2 (PFIC2) [MIM:601847]. PFIC2 is an inherited liver disease of childhood which is characterized by cholestasis and normal serum gamma-glutamyltransferase activity. Defects in ABCB11 are also found in cases of chronic intrahepatic cholestasis without obvious familial history of chronic liver disease.
    Defects in ABCB11 are the cause of benign recurrent intrahepatic cholestasis type 2 (BRIC2) [MIM:605479]. BRIC is characterized by intermittent episodes of cholestasis without progression to liver failure. There is initial elevation of serum bile acids, followed by cholestatic jaundice which generally spontaneously resolves after periods of weeks to months. The cholestatic attacks vary in severity and duration and patients are asymptomatic between episodes, both clinically and biochemically.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Domain

    Multifunctional polypeptide with two homologous halves, each containing an hydrophobic membrane-anchoring domain and an ATP binding cassette (ABC) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABC member 16, MDR/TAP subfamily antibody
    • ABC16 antibody
    • ABCB1 antibody
    • Abcb11 antibody
    • ABCBB_HUMAN antibody
    • ATP binding cassette sub family B (MDR/TAP) member 11 antibody
    • ATP binding cassette sub family B member 11 antibody
    • ATP-binding cassette sub-family B member 11 antibody
    • Bile salt export pump antibody
    • BRIC2 antibody
    • Bsep antibody
    • PFIC 2 antibody
    • PFIC2 antibody
    • PGY4 antibody
    • progressive familial intrahepatic cholestasis 2 antibody
    • Sister of P glycoprotein antibody
    • Spgp antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat pancreatic tissue labeling ABCB11/BSEP with ab217532 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded human liver carcinoma tissue labeling ABCB11/BSEP with ab217532 at 1/500 dilution overnight at 4°C, followed by a conjugated secondary antibody for 90 minutes and DAB staining.

    Antigen retrieval by boiling in sodium citrate buffer (pH 6) for 15 minutes; Block endogenous peroxidase by 3% hydrogen peroxide for 30 minutes; Blocking buffer (normal goat serum) at 37°C for 20 minutes.

References

This product has been referenced in:

  • Lee S  et al. Effects of Red Ginseng Extract on the Pharmacokinetics and Elimination of Methotrexate via Mrp2 Regulation. Molecules 23:N/A (2018). Read more (PubMed: 30424502) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up