Overview

  • Product name

  • Description

    Rabbit polyclonal to ABCB5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human ABCB5 aa 1200-1250 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    KARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFK L


    Database link: Q2M3G0

  • Positive control

    • Mouse melanoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/1000. Predicted molecular weight: 139 kDa.

Target

  • Function

    Plasma membrane transporter able to mediate efflux from cells of the rhodamine dye and of the therapeutic drug doxorubicin. Responsible for the resistance to doxorubicin of a subset of malignant melanomas.
  • Tissue specificity

    Expressed by CD133-expressing progenitor cells among epidermal melanocytes (at protein level). Widely expressed with specific expression in pigment cells. Also expressed in several malignant tissues.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABCB 5 antibody
    • ABCB5 antibody
    • ABCB5 P-gp antibody
    • ABCB5_HUMAN antibody
    • ABCB5alpha antibody
    • ABCB5beta antibody
    • ATP binding cassette protein antibody
    • ATP binding cassette sub family B (MDR/TAP) member 5 antibody
    • ATP binding cassette sub family B member 5 antibody
    • ATP-binding cassette sub-family B member 5 antibody
    • EST422562 antibody
    • P glycoprotein ABCB5 antibody
    • P-glycoprotein ABCB5 antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse melanoma tissue sections labeling ABCB5 with ab203120 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203120 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Flow Cytometry
Sample
Mouse Cell (Limbal cells)
Permeabilization
No
Gating Strategy
Limbal cells were harvested using FITC conjucation
Specification
Limbal cells
Preparation
Cell harvesting/tissue preparation method: Immediately after euthanasia of mice by CO2 narcosis and subsequent eye enucleation, limbal and central corneal tissues were removed with microscissors under a dissecting microscope, placed in low Ca keratinocyte serum free medium and centrifuged for 5 min at 250g at 4?C. After removal of the supernatant, tissue pellets were digested in 0.5% trypsin solution. For experiments, ABCB52 limbal epithelial cells were isolated by FACS using ABCB5 (abcam: ab203120) antibody labelling.
Sample buffer: Commercial Pre-Sort Buffer
Fixation
No fixation

Abcam user community

Verified customer

Submitted Sep 14 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up