Overview

  • Product name
    Anti-ABCG5 antibody [1B5E10]
    See all ABCG5 primary antibodies
  • Description
    Mouse monoclonal [1B5E10] to ABCG5
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WB, ELISA, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ABCG5 aa 306-367.
    Sequence:

    SVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVP FKTKDSPGVF SK


    Database link: 64240

  • Positive control
    • ABCG5 recombinant protein; ABCG5 hIgGFc transfected HEK293 cells; HL7702; Raji and Jurkat cell lysates; A549 cells; Cervical cancer tissues; Rectum cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab175421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 72 kDa.
ELISA 1/10000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function
    Transporter that appears to play an indispensable role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile.
  • Tissue specificity
    Strongly expressed in the liver, lower levels in the small intestine and colon.
  • Involvement in disease
    Defects in ABCG5 are a cause of sitosterolemia (STSL) [MIM:210250]; also known as phytosterolemia or shellfish sterolemia. It is a rare autosomal recessive disorder characterized by increased intestinal absorption of all sterols including cholesterol, plant and shellfish sterols, and decreased biliary excretion of dietary sterols into bile. Sitosterolemia patients have hypercholesterolemia, very high levels of plant sterols in the plasma, and frequently develop tendon and tuberous xanthomas, accelerated atherosclerosis and premature coronary artery disease.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily.
    Contains 1 ABC transmembrane type-2 domain.
    Contains 1 ABC transporter domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Abcg5 antibody
    • ABCG5_HUMAN antibody
    • ATP binding cassette sub family G (WHITE) member 5 (sterolin 1) antibody
    • ATP binding cassette sub family G member 5 antibody
    • ATP-binding cassette sub-family G member 5 antibody
    • ATP-binding cassette, sub-family G (WHITE), member 5 antibody
    • Sterolin 1 antibody
    • Sterolin-1 antibody
    • STSL antibody
    see all

Images

  • All lanes : Anti-ABCG5 antibody [1B5E10] (ab175421) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : ABCG5 transfected HEK293 cell lysate

    Predicted band size: 72 kDa

  • Anti-ABCG5 antibody [1B5E10] (ab175421) at 1/500 dilution + Human ABCG5 recombinant protein

    Predicted band size: 72 kDa

  • All lanes : Anti-ABCG5 antibody [1B5E10] (ab175421) at 1/500 dilution

    Lane 1 : HL7702 cell lysate
    Lane 2 : Raji cell lysate
    Lane 3 : Jurkat cell lysate

    Predicted band size: 72 kDa

  • Immunohistochemical analysis of paraffin-embedded rectum cancer tissues labeling ABCG5 with ab175421 at 1/200 dilution with DAB staining.

  • Immunohistochemical analysis of paraffin-embedded cervical cancer tissues labeling ABCG5 ith ab175421 at 1/200 dilution with DAB staining,

  • Flow cytometric analysis of A549 cells labeling ABCG5 with ab175421 at 1/200 dilution (green) and negative control (red).

  • ELISA analysis of ABCG5 anatigen at 10,50 and 100 ng, labeling ABCG5 with ab175421 at serial dilutions (10-2 - 10-5).

References

ab175421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up